PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00132g01412.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 273aa    MW: 31168.6 Da    PI: 5.9956
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00132g01412.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.7e-151562148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              rg W+++Ed++l+d++ ++G g+W++++   g+ R +k+c++rw +yl
  Peaxi162Scf00132g01412.1 15 RGLWSPDEDQKLKDYILRHGHGCWSSVPINAGLQRNGKSCRLRWINYL 62
                              788*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-22965IPR009057Homeodomain-like
PROSITE profilePS5129422.8541066IPR017930Myb domain
SuperFamilySSF466895.99E-201398IPR009057Homeodomain-like
SMARTSM007176.1E-111464IPR001005SANT/Myb domain
PfamPF002491.1E-131562IPR001005SANT/Myb domain
CDDcd001672.53E-91862No hitNo description
Gene3DG3DSA:1.10.10.606.6E-966106IPR009057Homeodomain-like
SMARTSM007171.667104IPR001005SANT/Myb domain
PROSITE profilePS512948.05167106IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MGCKQMDKPK QKHKRGLWSP DEDQKLKDYI LRHGHGCWSS VPINAGLQRN GKSCRLRWIN  60
YLRPGLKRGT FSIEEEETVL TLHGVFGNKT DNEIKNHWHS YLKKRVIKKA ENEGDARSGY  120
SSPQIGNEES SHSSMKLASQ NSSLDSFEHI ECSLLADTDQ SSSLQVDFAR ENCKSNLPRV  180
LFSEWLSFDQ LNGQDFKNSS NQESKNNFGY NNSVFQDSCM HGPLMNDINQ ALNRGMVDDM  240
FQPTLEFEDH ISADGFEELI SGEFNINGDM MYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-14151067108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629823.11e-129PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K43e-47LAF1_ARATH; Transcription factor LAF1
TrEMBLM1B4S41e-120M1B4S4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000370801e-119(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.11e-55myb domain protein 19